DPCstruct | MC6166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 212 ± 17 aa |
| Standard deviation of domain lengths | 16.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 29.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2KTD6 | 247-498 | RVNADANVKSCIAVGMKKYWRGLAAGTYFSDRRLAACIGVINTEIVQIWNFRDDDQILLRPSFQNAVLLLVQDLADPNGPSAGSDVT… |
| A0A4Y7PFF4 | 3-217 | GYWRGLASSTHFPGNLLRDCLGIIHKDIVKIWNFSDPDKILEDNVVKAMILELVQDLADPDASNPNSGFSEKLTTIKASLDVATPLS… |
| A0A4Y7QLK7 | 370-586 | None |
| B0D5W3 | 519-738 | None |
| A0A067PCF7 | 450-659 | None |
| A0A0C3PSS7 | 110-313 | None |
| A0A6A4GDV7 | 150-339 | None |
| A0A0C2ZJQ9 | 32-252 | None |
| A0A4S8MRW8 | 4-180 | None |
| A0A0C2WA13 | 185-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.