DPCstruct | MC61657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2MF26 | 2-103 | GEGRNVTLFDGLRKWAYRARLGYSDWHLWERACRSHADALNAFASPLTTREAHQVAKSVAKWTWTNITPTAFSKIQAERGSQNGANK… |
| A0A6D0VWD0 | 32-111 | GMGRNCHLFEMTRKWAYRAIRQGWPAFSQWLEAVIQRVEMYNASLPVPLSLAECRAIGKSIAKYTHRNFTPETFAQYVAD |
| A0A4Q5ZAT7 | 319-434 | None |
| A0A261E0A4 | 91-189 | None |
| A0A811GMX0 | 30-119 | None |
| A0A2T3J8W0 | 1-104 | None |
| A0A2S9SWT1 | 13-113 | None |
| A0A809RP62 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.