DPCstruct | MC61654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6CYU9 | 982-1110 | YRLEQIGQIFERLEFKRVKGSGQPRLCYFPPERPDERCFLPTGVCIMKTVKGPWTIALSKSANRKYFYNMSSRSSTFEAPPDSVASA… |
| B4GW44 | 1-162 | MCDKYARSLNKPYKKERSCGPLRSKPFFRLQDMNSFFSEMRHYVLKDNSQRFGFSLDDNKFFVPGSILMLCELNQSYVSAKSRSRNQ… |
| A0A5K3F408 | 1-139 | None |
| A0A834NIR3 | 906-1014 | None |
| A0A075AJ57 | 1023-1156 | None |
| K1RSM4 | 667-795 | None |
| A0A2S2NHU6 | 52-194 | None |
| A0A443SE66 | 140-278 | None |
| A0A0B7AXH1 | 124-275 | None |
| A0A7J8GP02 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.