DPCstruct | MC61648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.38 |
| Pfam Score | 86.99 |
| Assigned Pfam label(s) | CL0105- CL0021- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0H056 | 38-119 | RSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPATGVTEKRKCAKPF |
| A0A7J4B3I0 | 2-65 | GDVVKVVVSKVVRGGIDVSMKGADLGVVKAFCSACRHPLVLRKDNKLFCRNCNRTETRKIASSY |
| A0A6V7WZZ2 | 100-206 | None |
| A0A1S3E3F5 | 112-194 | None |
| Q12W28 | 160-237 | None |
| J5R8M2 | 93-156 | None |
| A0A226EM90 | 130-208 | None |
| A0A2S4L1X1 | 28-110 | None |
| A0A2T9X227 | 119-194 | None |
| A0A671EXV9 | 81-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.