DPCstruct | MC61647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1LF10 | 101-169 | GPVRASGTNIRTTLRIDYQPDVCKDYKETGYCGFGDTCKFLHDRSDYKSGWQLEKEWEQQQAEKRLKMQ |
| A0A072TQE4 | 60-134 | ATLETETSLEGTGGSTHGPLRPSTHIRVSSRIDYQPDLCKDFKETGYCGYGDSCKFLHDRTDYKSGWQLEKEWNE |
| A0A1B6CBU1 | 135-210 | None |
| A0A061F796 | 231-313 | None |
| S6BLY4 | 17-82 | None |
| A0A819TH13 | 50-131 | None |
| A0A7R9WTF6 | 1-78 | None |
| A0A183K8W5 | 69-135 | None |
| A0A6G3MGP8 | 55-110 | None |
| X6MQ34 | 38-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.