DPCstruct | MC61645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 6 aa |
| Standard deviation of domain lengths | 5.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0GQG3 | 1-115 | MFNKTNKKFPLGTFLANVFATLLIGIFTMVQRGKKHFSTDVPIVNSLNSCHIVSALISGFCGTLSTISTFINEGYKLSFINMLIYYT… |
| A0A1X2GW75 | 288-401 | APVGALLRWRLSFYNGATKFTPLGTFIANIFGTLVLAVLYLLRYSVPVSPISCLVLNALSDGFCGCLTTISTFVVELTILRHRQAYA… |
| A0A6A5WYS9 | 881-1004 | None |
| A0A482SQC4 | 3-111 | None |
| U7PUX1 | 398-515 | None |
| J8TST1 | 94-213 | None |
| V5GPP2 | 161-285 | None |
| A0A507C3U1 | 414-529 | None |
| A0A094EMJ8 | 411-533 | None |
| A0A1Q2YH53 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.