DPCstruct | MC61642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 103 ± 19 aa |
| Standard deviation of domain lengths | 18.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448X1S1 | 12-98 | TKVIELHEQMHQRCGVVIVGPSGCGKSTLLRLLRGGLTRLGQGPTVVFAFNPKSMPRTHLLGRVDVDTREWTDGVLTHAARSLARLG |
| X1X555 | 12-114 | LQCTSYFLEKIQQIYEMMIVRHGFMIVGLPFSGKTSAYRVLAGALAIIEEKKLMDEHKVEIMVINPKSITLGQLYGQFDMISHEWFD… |
| A0A2P8YXU9 | 1-76 | None |
| A0A2P8Y647 | 2-90 | None |
| A0A5J4VC04 | 9-95 | None |
| A0A151HE14 | 82-186 | None |
| A0A2D0QJU4 | 35-164 | None |
| A0A3Q0JIY6 | 40-120 | None |
| A0A0K0EA45 | 170-296 | None |
| A0A3Q0II71 | 13-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.