DPCstruct | MC61641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 52.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0RQ61 | 1-66 | MKDRWMNVGHEEEELKPHAEPEPDFNDTRRIDIMITMGFVRDEINDALINQKYDEVMATYILLGRK |
| A0A183AXM1 | 1-79 | MKDRWVNIGYEDNPLRPYVEPKPDVTDPSRISAMMNMGYHLDAILNSLKSGNCDEITATYYLLEKKDDKIRDRENEASQ |
| A0A267DT90 | 27-115 | None |
| A0A5K3EZ04 | 56-128 | None |
| A0A1I8IRD1 | 195-277 | None |
| A0A5F4WG04 | 26-106 | None |
| A0A1V4KPK5 | 1-67 | None |
| A0A0S7FX20 | 27-96 | None |
| A0A1A8DCC9 | 152-230 | None |
| A0A7R8H652 | 284-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.