DPCstruct | MC61638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6Y0P6 | 2-94 | LSQIMMHFQIPDSANTTLDFINTIYLTQIMQGLCYKAQTEFYRRSRNELVNGTGHTMGALYWQLNDIWEAPTWSSTEYGGKWKALHY… |
| A0A448WNW9 | 1-106 | MLFIYITASKFSYMYLTQINQAMAYKAHINRLMRHRCRLIGLNSTDPGSISGTGLSMGAMYWQLNDVWSAPTWSTLDATGQWKMAHY… |
| A0A5N5SNS3 | 25-126 | None |
| A0A2G9TY61 | 83-167 | None |
| A0A821FNU4 | 23-100 | None |
| A0A3G5AP01 | 17-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.