DPCstruct | MC61631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 165 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9TLJ0 | 252-432 | TSNESLFFGVIHIVTNFGIVFMDTGFWQKGFSADIAAAVPGYIIGGNAYFAIPFTFGTVVGLGALALEQTPIWPTYPRRMTQAEVSG… |
| A0A448WFU0 | 1-139 | MSRNLSVIFMDQAYWLVAINAKPNHGIFGFIFGSLIWFALPMCFGTACGLAYLALELINGGPIVSAKEISMGIAPFVVIGSILGAPG… |
| A0A0D2J3A1 | 96-254 | None |
| A0A146F576 | 75-261 | None |
| A0A7S4MPV0 | 12-142 | None |
| A0A0N8H7N1 | 1-136 | None |
| I2JZB8 | 29-197 | None |
| A0A1L7XW68 | 171-351 | None |
| A0A448XH06 | 11-142 | None |
| A0A7W0L2K5 | 39-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.