DPCstruct | MC61630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448WF14 | 1-56 | MGGASMQIAFEIPENVNPPIEFVSQINLGCDDEIRDHVYRIYVTTFLRYGSKEARE |
| A0A6P3RSE4 | 1-72 | MGGVSTQIAYEVPKTVSFASSQQEEVAKNLLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDKIFA |
| A0A3P7LGR7 | 54-109 | None |
| A0A218U743 | 273-343 | None |
| A0A493U3C2 | 242-317 | None |
| A0A834FF96 | 91-158 | None |
| A0A6F9C6K4 | 265-337 | None |
| A0A819S8P4 | 88-156 | None |
| A0A2U9BRQ3 | 625-694 | None |
| A0A6A4SNB4 | 842-919 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.