DPCstruct | MC6163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 175 ± 34 aa |
| Standard deviation of domain lengths | 33.54 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QH01 | 6-187 | ISPFPMNPFFKPQPPLSDSTKEEIWLKFTQEGQTPRKIGFDYGVSLKRVEAILKLKKLEKDMEKKGITLQKNLSENIEKMLGARSFC… |
| A0A4R5XGL7 | 35-191 | ENKSLQTGFLAGMEEMLLAQTRTLSQEASERESKLADKQDEDQGFESTRDRYQRLFWEPVAEHESPVVPSSIERGDEEKRRSREEAR… |
| A0A177VC41 | 167-402 | None |
| A0A4S4LKB1 | 79-298 | None |
| A0A409VDS2 | 60-234 | None |
| A0A0L0T1Z9 | 41-245 | None |
| A0A146IHU2 | 143-335 | None |
| A0A5C3MAQ1 | 55-241 | None |
| B8PFW8 | 63-260 | None |
| A0A6A4IL03 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.