DPCstruct | MC61628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Standard deviation of domain lengths | 20.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448WDG8 | 1-139 | MPHNLDSLSDLSVLANGLQFDPLPSPRPLDPSLSHAPKLNHELTPEESVQAVVNALRYFPNRLHAQLAGEFARELETYGHIYMYRFR… |
| A0A7J7JLP7 | 1-128 | MSEGDIKAQLVRLCSGIPLSPLPPRVEKRDESLPHAPVLTPVLSEQDCKLAVKNALRYFPKDIHKELAAEFAQELKLYGHIYMYRFL… |
| A0A0M3IGF3 | 1-137 | None |
| A0A3M6UH19 | 7-95 | None |
| A0A521WL82 | 4-153 | None |
| A0A820ZSE5 | 1-139 | None |
| A0A820X0J8 | 1-139 | None |
| A0A3F2RPA1 | 341-492 | None |
| W1I6G3 | 16-153 | None |
| A0A7J0AVQ6 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.