DPCstruct | MC61625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 249 ± 45 aa |
| Standard deviation of domain lengths | 44.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 99.47 |
| Assigned Pfam label(s) | CL0020- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4DJY4 | 17-210 | DDLLVVLHSLIESGDLSYQESLHCVQTAFHILSGQGDVLNIDPMKFYTHLYKTLFKLHAGATNEGVEIVLQCLDVMLTKRRKQVSQQ… |
| Q6NME0 | 5-253 | MNYLKKLASSSSSVSNNTKQKNSKLLTVSERLRCCLVAFKVMRSNLNALNVDLQDFFVQLYNLILEYRPGRDSGVILAESLKIMLCD… |
| A0A4S9LXZ2 | 595-838 | None |
| A0A0C2JIC5 | 28-225 | None |
| F4Q481 | 614-891 | None |
| A0A7S4PLA8 | 17-231 | None |
| A0A2A2KIS7 | 342-593 | None |
| A0A0M3INC7 | 120-347 | None |
| B6AG04 | 339-629 | None |
| A0A4S4CWD9 | 225-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.