DPCstruct | MC61620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14389 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q45GF9 | 35-174 | KGCENGVVNRKALNREKIITLQEDVEKLRKKLRLEENIHRAMERAFSRPLGALPRLPPFLPPSVLELLAEVAVLEEELVRLEEHIVH… |
| A0A0K9PF76 | 1-110 | MSKAMAQQLAMSRRERKLSLQQDVDHLKRKLLKEKNIHRALERAFTRPLGCLPRLPPYLRLYTSELLAEVALLEEEVARLEEQVVCF… |
| A0A7N0V0T1 | 18-176 | None |
| B9S8J2 | 8-132 | None |
| A0A834L421 | 242-356 | None |
| A0A3L6TCK1 | 203-344 | None |
| A0A0L9UR41 | 1-147 | None |
| A0A2K1KZU6 | 20-181 | None |
| A0A445HY01 | 10-153 | None |
| A0A059B093 | 32-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.