DPCstruct | MC6162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 153 ± 19 aa |
| Standard deviation of domain lengths | 19.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J4G8G4 | 408-559 | RARLYWSDPVAEQRCLGYEMRKYHAELFNIPEGEDTQRWCMETSINIHGKTYDHPDICTEEYVDGIVKIVAHWTVKGNEPTCRTWWG… |
| A0A4R5XFW3 | 3-153 | WDEPRPSRCVEYGIREYTAHLLDIPSTYDRRKGCEYTPVTINGFSLETPTYCDDKGWWSGVFGHWHLDNQTICTPYWASPLEDVGCT… |
| A0A166JYL1 | 72-249 | None |
| A0A4S8KL24 | 64-228 | None |
| A0A0D0BY45 | 7-118 | None |
| A0A1C7MGV0 | 107-292 | None |
| A0A1C7MGZ4 | 65-211 | None |
| X8JBT6 | 243-387 | None |
| X8JCT4 | 306-447 | None |
| A0A409WDW6 | 143-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.