DPCstruct | MC61619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0506 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167DW56 | 109-186 | GIANFTQVGSTFKGIIRAFRDYKNALHNHKVRIYIRRGGPNWQEGLRLIKNAGEELDLPMEIFGPDMHVSGIVPLALL |
| Q42079 | 1-84 | GIANFTDVAATFNGIIRALKEKEAKLKAARMHIFVRRGGPNYQKGLAKMRALGDDIGVPIEVYGPEATMTGICKEAIQYITAAA |
| A0A813UVU4 | 334-395 | None |
| H3A1H0 | 286-363 | None |
| M7YPN4 | 334-395 | None |
| M5FQP0 | 388-466 | None |
| A0A6V7P7J3 | 337-396 | None |
| A0A5N5SJI2 | 199-277 | None |
| A0A5K3G1G0 | 81-159 | None |
| A0A060WTD0 | 99-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.