DPCstruct | MC61614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 545 ± 53 aa |
| Standard deviation of domain lengths | 53.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.14 |
| Pfam Score | 96.51 |
| Assigned Pfam label(s) | CL0409- PF03836 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444T2L8 | 1-514 | MRLSDMISTNPLIIRIIVSLHRKGHGQSKLKEIVGPLIEEVLKDSTLHLNTNPVEIYRNWVNQIEMGTGNASNLPYVVKTEEALQYP… |
| F2SE24 | 11-506 | SLPPYLERAVTAEVAAENEQVQAIIAPRLKMLTDLANSFLKTIIDGLEETPYGIRWICKQIRSLSKRKYPDAQDHVICTLIGGFFFL… |
| Q5AH02 | 1061-1636 | None |
| A0A3M6UT71 | 125-649 | None |
| A0A812VVB8 | 1-582 | None |
| S4RYT1 | 76-625 | None |
| A0A4Z2IA39 | 255-842 | None |
| A0A6A4WXF8 | 656-1256 | None |
| A0A2T6IZE9 | 1-471 | None |
| X6NGM8 | 239-759 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.