DPCstruct | MC6161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0WFW5 | 2-79 | SNLFQIICPKRNYGVGQRVSRSIWNRFTEPCYWEITRIRPAPDLKHGKAFGRFTFRGKTDPKEKRINNPLKKDWLPAP |
| A0A4R5XEJ4 | 25-129 | ERIANLSAQPRNLFETLSRMPHDGVGARVFQTRWQSKGIEGCCWNITRVQTKLDGTRGKAWGMLVWRGKEVSEREEQIRGGLKWKWA… |
| A0A5B8MQL9 | 4-90 | None |
| A0A146I3H7 | 13-105 | None |
| A0A4W2H7K7 | 357-454 | None |
| A0A2H3BLP0 | 17-123 | None |
| A0A7S4UU01 | 26-113 | None |
| J4U7C7 | 2-100 | None |
| A0A1Y2H9L6 | 27-140 | None |
| A0A2G8L0Z9 | 6-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.