DPCstruct | MC61609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 171 ± 15 aa |
| Standard deviation of domain lengths | 15.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444SK05 | 4-172 | NVVKEIKEEIAKLCDKIYCKKPEEQMSLEHSSIKIYRTLQNEEKVFAVHKINDEIKYGKVSLFGNQIFFYSLSLSETPKDSSLIWFE… |
| A0A444SHG1 | 20-161 | FQDSQGYLEEIYKRVQNEEKIFAVRKIEDKIKYGKISKYENRLFFHSLSLSEVPTDSSLIWFDELKQCATATNLYTFMEVCCNNKSL… |
| A0A444SZP5 | 39-218 | None |
| A0A444SY71 | 12-195 | None |
| A0A444SNJ1 | 119-258 | None |
| A0A444SKG1 | 175-322 | None |
| A0A444SJ11 | 20-193 | None |
| A0A444SE75 | 154-334 | None |
| A0A5B7CQ62 | 745-935 | None |
| A0A423S9J0 | 184-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.