DPCstruct | MC616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 156 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4WTQ4 | 76-227 | TDLLASIELDWVALSRREPDDEQSHVLYSSLMIALSRLALTECGWNTLAELALPEVLAELRVFSNPPKQMFLEPASVKKKGSPAELY… |
| A0A0B1SDR1 | 1-156 | MTDLLASVKMDWTALSKGDPEALHIYGLFKSLMLTLTRLSLTESGWNALAELALPEVLAQLQMFVSPPKEVFLQPASVKEKNSVGEL… |
| A0A183HDX0 | 55-207 | None |
| A0A183FSZ6 | 3-162 | None |
| W2SRP2 | 66-203 | None |
| G0NR56 | 124-285 | None |
| A0A0D8XCV8 | 2-156 | None |
| K7HXF2 | 4-142 | None |
| A0A0N4UDS2 | 54-211 | None |
| A0A2A2JVW2 | 84-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.