DPCstruct | MC61592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 56.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699GP02 | 2-140 | QLSTEQAFCLPLLNPKSEKLHIIQTPVEIEISKELPKISLVKTSFQKLKNDLASFDKVVKVKTTPDAITERSWGFERTKKVFKEEDI… |
| A0A699MBZ2 | 5-142 | KLSAEQAFWSQYSVNSKEPNLSSSTTIVEVPEELPKVSMVNSSLKKLKFYLASFDVVVNKRTTSTAITEGTWGFEHTKACFMDEIIP… |
| A0A6L2P0C6 | 368-552 | None |
| A0A699NPL4 | 77-196 | None |
| A0A699J9N3 | 29-173 | None |
| A0A6L2NHI3 | 323-465 | None |
| A0A699JBB2 | 4-150 | None |
| A0A699HH54 | 145-286 | None |
| A0A699QFJ5 | 1-122 | None |
| A0A6L2L4F1 | 120-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.