DPCstruct | MC6159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4BKG1 | 4-96 | AGRSPGGLLKTLEALARSGAHRETWQITRALLPALLAGPGERATTVHTRVVSFAADVAEWAGARGELPEIAALAARPGSSHLTRHAR… |
| W7VRK3 | 413-533 | ALDALLLLAAAGDLDAPAVGGHLGEMGAQGQVILTRAVTPLRDALAAGARLSVWRLLAAALPPLLAGPTPPRGTPDLLALAAEAATA… |
| A0A7W5Y9K3 | 27-136 | None |
| A0A4V5V0H4 | 525-636 | None |
| A0A1Q9U8V2 | 840-945 | None |
| A0A2P9IAH8 | 264-391 | None |
| A0A5J6U270 | 253-358 | None |
| A0A171DN41 | 16-116 | None |
| A0A1U9NS13 | 362-479 | None |
| A0A2P9IXN5 | 106-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.