DPCstruct | MC61588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 349 |
|---|---|
| Mean domain length (aa) | 221 ± 47 aa |
| Standard deviation of domain lengths | 46.78 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 99.05 |
| Assigned Pfam label(s) | CL0758- PF10283- CL0004- CL0028- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5CND4 | 3-157 | CWLRHGYMTNDFTNMFINTVNLIVFWGYIFAFAFYQPRRKHLYGQLFALFFSLLCIFSYVNWQPLEEAADVMGGISAAMQIFSLAGQ… |
| K3XLL2 | 17-228 | NIFALALFLSPVPTFKRVVKAKSTERFDGLPYLLSLLNCCICLWYGLPWVSDGGRTLVATVNGTGALFQLAYISLFIFYADSRSTRL… |
| A0A7S4PQS2 | 92-313 | None |
| A0A1R3K865 | 5-150 | None |
| A0A1V2LJS4 | 286-625 | None |
| T1NMW0 | 2-141 | None |
| A0A0P1AY49 | 21-246 | None |
| A0A166BBP0 | 10-191 | None |
| A0A5D2T3H0 | 8-177 | None |
| A0A199VR69 | 12-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.