DPCstruct | MC61584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 142 ± 28 aa |
| Standard deviation of domain lengths | 27.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.18 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0229- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8XUQ2 | 1-141 | MLRKASKENIVVDLTNLYDHFFLTTGECKAKVTAGRLPYFDGDYWPGAAEDLIIQLRQEDGRKLNKKGTIKKTLTKRALKASGQADL… |
| G7ZY55 | 273-392 | MLTKATKENVVVDLTNMYDHFFVSTETRYSKVTTARMPYFDGDCWSGAAMDQAVIIEKECEAMGYVNPPNAKAKAKDILVMQKLGQI… |
| U5CSJ3 | 346-475 | None |
| A0A7S2Z3P0 | 73-222 | None |
| Q9C5X9 | 1284-1429 | None |
| A0A6S7M3V7 | 229-344 | None |
| A0A7J9HNR6 | 1-142 | None |
| A0A6P5G126 | 175-312 | None |
| A0A0L9UT52 | 319-451 | None |
| A0A287XFW3 | 540-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.