DPCstruct | MC61582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 63.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0716 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8XF49 | 1-110 | MEGKEEDVRLGANKFSERQPIGTTAQTDKDYNEPPPAPLFEHGELYSWSFWRAGIAEFVATFLFLYITVLTVMGVNRAPSKCASVGI… |
| A0A287H2A4 | 25-129 | QPAAAMAKEVSEEPEHAAPARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQSAADPCAGVGVLGIAW… |
| A0A1D6EMF1 | 1-110 | None |
| A0A1D6E3H5 | 1-112 | None |
| A0A1E5W605 | 10-110 | None |
| B3U2A8 | 1-124 | None |
| A0A1S4BJ00 | 1-110 | None |
| A0A2I0AV55 | 10-111 | None |
| A0A7J0EFW1 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.