DPCstruct | MC6158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239K8J2 | 3-91 | DTAPALQTRPFGPMDALYCALRRSLPQILAVHVRDPEEYIRVTYRAAGPADIAWDDDAEQYRWSAGATGMLGSRAELDRVVAAVAEH… |
| A0A846YYA6 | 21-111 | DELPRVRRGPLHSLYAALRRRAPQVSATRPGDGEDVLRVAYRGRAAQVVWDDGLEVFAWAAADGGPIGPDAEKAAEVIASALDAPVS… |
| A0A6L9QSF3 | 3-92 | None |
| A0A372GPE5 | 2-85 | None |
| A0A5D0ULB3 | 31-130 | None |
| A0A5D0U5V2 | 1-95 | None |
| A0A7K1LDT5 | 103-211 | None |
| A0A543INM8 | 26-131 | None |
| A0A3N1D6H7 | 1-105 | None |
| A0A6L3VYB4 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.