DPCstruct | MC61578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1UME0 | 11-79 | LRFVQWYNTVHRHSQLNYVTPQQRHEGKDREILAKRHKVLANAKRDNPMRWGSRAVRNCTPLGVVTLNP |
| A0A0D0LSC5 | 1-83 | FTSIDHARTWTAQFLNRYATEHRHSGLGRHTPATVHQGTAHLIRQDRQHHLHCYYAQHPERFRRPPRAPELPGPTGINHHKLS |
| A0A2A3G788 | 91-182 | None |
| A0A2E2PFR9 | 86-175 | None |
| A0A6L3EL04 | 153-260 | None |
| A0A1Y2KI02 | 57-148 | None |
| A0A6I1R439 | 195-284 | None |
| A0A7I7PJG1 | 2-74 | None |
| A0A5C7T1G3 | 22-102 | None |
| A0A1Y6CLM4 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.