DPCstruct | MC61570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.21 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0126- PF16491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9GDK5 | 171-305 | LLLMSVFSRLIDLPFSIYKTFVLEERHGFNRQTPWFFAKDKLKAFIVDLVITVPITVGVLYIIHAGGELFFVYLWGFCCVVSLFLMA… |
| X1WX63 | 1-134 | MTSCVFLLCMNTLGTLMSLPISAYSTFIIEEKHGFNKQTLNFFVKDKIKNFLLVQVISLPITAAAITIVKWGGRYFFIWLWVFAVVT… |
| A0A5A8CHY1 | 199-328 | None |
| A0A6G5A0R8 | 142-272 | None |
| A0A7J6U771 | 39-169 | None |
| A0A7S4A9H2 | 197-333 | None |
| A0A816SVF5 | 130-264 | None |
| A0A7T9CZ74 | 100-230 | None |
| A0A1R3H290 | 333-460 | None |
| A0A0R3SB35 | 132-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.