DPCstruct | MC61565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072VAY3 | 77-184 | DVNPSNQSGSNYNKRKSNAGKEQFDKDSLRLNAQAKAGKREKTENTMDSVDWDDVRCVDCKKIADAIKERGINNKLAKHIQNFLIRL… |
| A0A540L8I0 | 62-157 | RRKGKADSEKKNAVDWDILRKQVQANGRKKERNKDTMDSLDYEALNNANVKEISEAIKERGMNIMLAERIQEFLNRLVKEHGSIDLE… |
| A0A7J0E4R5 | 31-141 | None |
| A0A4D6MKB0 | 13-125 | None |
| A0A2Z6MQY8 | 194-311 | None |
| A0A2I0WS47 | 145-258 | None |
| A0A446K8D4 | 241-360 | None |
| A0A453S050 | 252-360 | None |
| A0A5P1EWI6 | 49-148 | None |
| A0A151TV26 | 474-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.