DPCstruct | MC6156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 19.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8E0L1 | 3-194 | SIRHTLRSLISKHYRNELKNHQKELQAKKEAADYFAHLPPCRGTVLIADPSYGEGEYQCSVTIPAHALLDWTKGQAERTIMRWPDEM… |
| A0A522XAP4 | 90-245 | ELARKRTGFMDNPPPCGSTISVTGMHGWTNIKGEFLFPASAAHEFALKKWREDRKLPGLRGAIWWLGLRNDDLGEKTPVPEILLNFD… |
| A0A506RXY3 | 81-239 | None |
| A0A849UEF9 | 46-178 | None |
| A0A142BBJ4 | 24-169 | None |
| A0A431WQJ1 | 32-185 | None |
| A0A3N5Y891 | 18-175 | None |
| A0A1V5HIU0 | 41-176 | None |
| A0A202C030 | 1-145 | None |
| A0A857JP11 | 89-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.