DPCstruct | MC61556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 233 ± 48 aa |
| Standard deviation of domain lengths | 47.68 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5ZXK4 | 203-457 | ELAVAYEMNFNVPPAFVEDALAGRTGANPDIIVLRPLGDVGDALPSSQDEWRRALTHAEALVRALGAFSTRIHLFARAPLPLMFHLG… |
| A0A4Q3YIS2 | 39-241 | DHEEAYWAGQDRNLEMAFARKIKERIEQREIRQLSVFALAPQPLLIRLGTLLGDVVPVSVHQKHREPDTWKWLPDQPHIAYKVNEYS… |
| A0A3P1T6T5 | 206-475 | None |
| A0A2Z2P2Z2 | 3-165 | None |
| A0A7Y4RPX5 | 3-259 | None |
| F7K3P7 | 118-360 | None |
| A0A7T8HP01 | 29-202 | None |
| A0A7J9THD0 | 28-281 | None |
| A0A0F9KBK3 | 20-292 | None |
| F0C5B2 | 168-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.