DPCstruct | MC61551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 129 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1TW54 | 13-127 | KAAYTTHLVRPESMSTLLVAPELRPHAGDLVLARVERIGQHKCLEGPDGRKAALFCGDEIVVVYGNRYAPDQFEAEVPSDLSACELV… |
| A0A534D1Q3 | 10-149 | LDRVRLAKSGYSVRRVDLSDVSDVVTDVRPKAGDLVLARVTRLGQHQHLEFVNGRRSRLWPGDEIVVAFGARYAPDQYEAVVPDDLS… |
| A0A136JR04 | 10-160 | None |
| A0A5E6NFK3 | 6-123 | None |
| A0A830HCD9 | 39-180 | None |
| A0A6L3ELB2 | 79-190 | None |
| A0A2V6XNS2 | 8-146 | None |
| H0A9N5 | 5-122 | None |
| A0A1R4G212 | 18-163 | None |
| A0A535M5E6 | 12-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.