DPCstruct | MC61542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 38.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0N1V6 | 1-137 | MEFFKCTIGGEIYGTGMTEIERGVAERKGIKVQEVPTSINSVREKGFNFDDVRLMRGAWRNEPNPDACKEFFRCLAICHTVLPEGDE… |
| A0A820EWK2 | 1-106 | MTFNKCSIRGNLYGYVMDEAGNEIQDPEKMKEIEFEEKDDDFTWYDQKLLDEIKKGDKDVHNFFTLLALCHTVMPEEKDGKIIYQAQ… |
| M7YB58 | 160-282 | None |
| A0A4Y2ITT8 | 40-149 | None |
| A0A0F8CFU1 | 411-534 | None |
| A0A1I8BU94 | 144-253 | None |
| A0A453RFR9 | 41-165 | None |
| A0A670Z2J4 | 260-375 | None |
| A0A446IRQ8 | 57-177 | None |
| A0A0R3S3R4 | 122-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.