DPCstruct | MC6154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 161 ± 24 aa |
| Standard deviation of domain lengths | 23.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A202DIP9 | 2-128 | KVTINPAKPIHPAIFEMVECWLSDTASPVVTEINLDAVEKNRNQFDYTRLQKDGDWTEIDCTEKGGGYAFLRYKVLDSKGNCQKVLF… |
| A0A849RW01 | 94-275 | SGGREEHSPEHSRYSFVREEFIHPLIVRELLGWLSDPAETIAAVDLASANRSNRFFGDFLASTRNGRAWVEWAGTERESFAYSHIAT… |
| A0A7W0JF02 | 213-393 | None |
| A0A1Q6UL14 | 179-331 | None |
| A0A2V6BEA3 | 187-315 | None |
| A0A5S3TQP0 | 24-181 | None |
| A0A0J8XZZ2 | 17-180 | None |
| A0A2V5YMM4 | 1-133 | None |
| A0A3D9WUQ8 | 34-211 | None |
| A0A163Y4L1 | 18-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.