DPCstruct | MC61536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 252 ± 73 aa |
| Standard deviation of domain lengths | 73.45 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01969 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369LAZ3 | 1-182 | MKTLFWNVRESATRAALLEATCSQLDDEARGAVEERCCAAGVPDGHCHYLAEVHAVVDALCASDRVKQDLRSVYRILAEAEAAAHGC… |
| A0A2R6J0A3 | 2-336 | RTLAFDGRMGASGDMLCGALLAAGADPEALEPVEACLDVRYAIDEVRKNGVRATTVDVLLDADDERDGHDAADADDGHDHHDQRRNH… |
| A0A0P1B7K6 | 1-139 | None |
| A0A496TII8 | 2-293 | None |
| A0A7Z8LC27 | 1-371 | None |
| D4IXL5 | 7-197 | None |
| A0A523B9C0 | 1-202 | None |
| A0A1C5N2M2 | 2-349 | None |
| A0A1H5YLK6 | 216-360 | None |
| A0A1I5UF07 | 2-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.