DPCstruct | MC6153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 63.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2E7A4 | 1-104 | MVCASKRPKVNLVQTESNDALKDEIVVPRGTLVTCIAGIKLQSEDVGAAIQFLEFCRSFGQVCRITEGQPEETLSDLTQLEEVSSAV… |
| A0A453NFY0 | 83-189 | AGPTVHSVKRPKGNLRRIESTDALKDEIVIPKGTLVTCVAGVEMQPEDVGAAIQFLEFCRSFGEIFQIRKGQSEKIVKDITGDRQLR… |
| A0A287TN96 | 120-226 | None |
| A0A287TMW6 | 141-248 | None |
| A0A287TMU2 | 76-173 | None |
| A0A3B6NL61 | 5-120 | None |
| N1R0C3 | 1-95 | None |
| A0A453NG19 | 174-286 | None |
| A0A453NFT9 | 70-199 | None |
| A0A0E0NDP5 | 403-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.