DPCstruct | MC61527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533ZMF2 | 4-77 | NRIEVRTRLVRRYTVFLNQKLVDLAKPVTIVTDGHVSYEGLVVPTVETLLRDARLRQDRGMLFPAMLTISVERG |
| R5VF75 | 499-569 | NVFRVQTSCVDVFRLYISPEMVDMNKKVKVYVNGKLKFKRKVKWDDAFLRQTFRRYYDRRQLWVNCIEIKV |
| A0A4V0WUP3 | 405-481 | None |
| A0A2E1H3C8 | 771-853 | None |
| A0A7C7WSJ2 | 699-781 | None |
| A0A4P5ZIS5 | 411-487 | None |
| A0A7Z1L5V4 | 63-134 | None |
| A0A3D5K1K5 | 125-203 | None |
| A0A2V2S3X2 | 1037-1111 | None |
| A0A1Q7ZHD1 | 230-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.