DPCstruct | MC61525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 210 |
|---|---|
| Mean domain length (aa) | 276 ± 79 aa |
| Standard deviation of domain lengths | 78.91 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 94.88 |
| Assigned Pfam label(s) | PF06455- CL0425- CL0324- PF00662- CL0392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533ZLL3 | 307-593 | FYLFFMNRLYVDALALRLGRGFTRVAHRLDTSRLFPYVAGLIALGLVLPAAVWTGELSAANITLFFVAALMIPLFPLHGVYVAALTR… |
| A0A3B1CNN1 | 2-208 | SSLAIIGIIYGALVAMVQEDVKKLVAYSSVSHLGFVMLGIFAMNTQAIEGGMLQMINHGISTGALFLIVGVLYERRHTRLISEYGGV… |
| A0A4Y7JLH6 | 9-166 | None |
| A0A2G4IU24 | 162-370 | None |
| A0A2U2SJ41 | 6-452 | None |
| A0A7V1N2K9 | 23-226 | None |
| A0A6P8C2G2 | 39-260 | None |
| A0A3L7Q348 | 45-324 | None |
| A0A837Q744 | 2-191 | None |
| A0A7C1Q440 | 22-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.