DPCstruct | MC61524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 215 ± 27 aa |
| Standard deviation of domain lengths | 27.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 46.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533Z719 | 1-199 | MIIVADNTDIAEHFHQIISGEEIIKAVVTEDEDDDEDAPKRKKKSKQQKCYGSGIVGFPELWNQKGFEVTLRIDSELLSAAESADPK… |
| A0A3N5HP30 | 218-410 | ALYGHYKKTFDLWKESGMRVPPCFIVVCNNTSTSKLVYDYISGFQRENEDGSTTLENGRLELFRNFDEHGNPIARPNTLLIDSEQLE… |
| A0A2N9NU64 | 66-267 | None |
| A0A4Q5RF41 | 470-737 | None |
| A0A3L7Q9E2 | 459-669 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.