DPCstruct | MC61521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 141 ± 22 aa |
| Standard deviation of domain lengths | 22.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2Q1K8 | 126-263 | LKRLRQDFAQIRGFYEANDDIETALLDQSVQHSFESNFACQAMNSILEFYLNTVLPSAVAGVTEETTDLKPHVESIQQIFDELKSDV… |
| A0A3P8XA83 | 68-214 | CGLGHGLHLGACSVNIHTHELRRHYTEIRTAVVASDSEPGVRMIRGDMMKSIPVKECCCFLRLLLNFYVERVFISYGSSQPQHRRTT… |
| A0A5S8HZ52 | 166-304 | None |
| F7C9S3 | 20-159 | None |
| A0A3Q3FC81 | 7-135 | None |
| A0A212CR57 | 3-128 | None |
| A0A7J8BEX2 | 1-129 | None |
| A0A2K6G891 | 1-126 | None |
| T0NRE5 | 23-143 | None |
| A0A401SGD7 | 4-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.