DPCstruct | MC6152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Standard deviation of domain lengths | 14.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444XVM7 | 683-784 | LGGTQHHYCGLAQYINLIGASIGYTITAAISMVAIQRSNCYHKNGHDAVCTMPNYPYMIMFGIIEIILSQIPDFHELSWLSALAAIM… |
| A0A453R7E3 | 4-96 | GSRQVWFCGLCQYVNLVGTAIGYTITASISAAALYKADCFHKNGHSADCGVYTTMYMAVFGISQIVFSQLPNLHEIAWLSILAAVMS… |
| A0A2P6Q051 | 130-238 | None |
| A0A328EA87 | 79-181 | None |
| A0A453C6P6 | 2-134 | None |
| A0A7J0FCS1 | 96-198 | None |
| A0A453G7G8 | 176-272 | None |
| A0A2U1PX65 | 154-253 | None |
| A0A287M939 | 26-117 | None |
| A0A445DZZ6 | 13-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.