DPCstruct | MC61519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376ZE21 | 1-68 | MAWTIQKPYRGKHKILVIAADERYLPTDNGKLFSTGNHPIETLLPLYHLHAAGFEFEVATISGLMTKF |
| A0A2T4RMQ8 | 8-77 | FDGVEHKGAYKDGKWKVLMIAAEERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVASLSGYPAKL |
| A0A2N8ZM37 | 1-72 | None |
| A0A5J9WZ31 | 41-104 | None |
| A0A1B8ARU3 | 38-105 | None |
| A0A380EE68 | 1-52 | None |
| R1IVU9 | 36-95 | None |
| A0A2X3K964 | 41-104 | None |
| A0A098SCN4 | 48-105 | None |
| A0A2X5ASW0 | 48-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.