DPCstruct | MC61510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376W950 | 14-115 | ISLQTVAAVRESAPEGTRTQASSQVSTTTQALQQQAAQWGVTEEDYRRYRALMEGPRGMQSPGLDPLTVLGIEARTDAERRQLAEKW… |
| A0A6L9JUN2 | 23-120 | TQQQVTQAENHRIQAQMWGLTEAEFQRYQQLMQGQRGIQSPGLDPLSALGIEAETVQARQRYAELWVRQEYVRTEKELAFQRAVDAA… |
| A0A2X2BTV8 | 1-121 | None |
| A0A8A8UW83 | 9-157 | None |
| A0A420S100 | 410-522 | None |
| A0A558HMN6 | 3-128 | None |
| A0A0Q4Y1T3 | 13-141 | None |
| A0A5E5QY74 | 1-143 | None |
| A0A837JTC4 | 1-107 | None |
| A0A170QE87 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.