DPCstruct | MC6151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 48 ± 5 aa |
| Standard deviation of domain lengths | 5.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0KN97 | 53-98 | KNPGVWFMHCHIERHLSWGMDTAFIVKNGGPPNTHLLPPPPDMPRC |
| A0A453R463 | 1-52 | NSLCICSCLGVWFMHCHFDRHVVWGMNTVFIVQDGKAPEVKMLPPPPNMPTC |
| A0A2G3APB6 | 48-94 | None |
| A0A438FDA3 | 132-176 | None |
| A0A6A6MQY7 | 24-82 | None |
| A0A438BL95 | 102-147 | None |
| A0A287GWQ5 | 1-43 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.