DPCstruct | MC61507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 10 aa |
| Standard deviation of domain lengths | 10.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376W000 | 1-134 | MQGEFDLMTSDYASHPQHFNHMVDAFRRDLKQYHSQLNKITDAPWFCGDTTWYWKENFPHAYEAIYGNYQNNVLANIIFVDFQQQGE… |
| A0A853WMM4 | 114-262 | MQGEFDLMTSDYASHTQHFNHMVEAFRRDLKKYHSQLNNITDAPWFCGDTTWYWKENFPHAYEVIYGNYQNNVLANIIFVDFQQQGE… |
| A0A4C3Q3N9 | 1-128 | None |
| A0A376YE01 | 37-170 | None |
| A0A827FLM5 | 246-393 | None |
| A0A828HVP6 | 2-135 | None |
| A0A828B633 | 2-156 | None |
| A0A826LEG5 | 242-390 | None |
| A0A823AD47 | 1-124 | None |
| A0A4B9BN95 | 41-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.