DPCstruct | MC61495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B1L6P3 | 30-116 | YQKYRKISHKFELKQRLYFLMKQSKSFDDFLEKAVQLHVRIDFSQKHSRFIMTDRAMTKPIRGRQLSKRDLYDEDFFRTHFAKREIE |
| M5K5U8 | 2-77 | KQRLYFLLQQSKSFDDFLEKAKQLHVQIDFSQKHSRFLMTDRTMIKPIRGRQLSKRDLYDEEFFRTHFAKQEIESR |
| A0A4U9Z5P5 | 27-111 | None |
| F9PAS0 | 41-135 | None |
| A0A2V2FEI8 | 14-100 | None |
| A0A380IKK4 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.