DPCstruct | MC61494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 397 ± 67 aa |
| Standard deviation of domain lengths | 66.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3NL84 | 41-411 | IDCMMCHEQYGLYDSEARAEKIEEGDYEDANSAAMVNSSFAARTNPIQFFVYNANLLTPYPLLIVFHDNVNGAPQESSCAEKCHITD… |
| Q64BJ9 | 19-375 | MGEATHVVGKEGKMTGKLVGINDFCIAVKSNEALCGKCHAGYGLSEHDFSVGKIDCLICHAPNYKKTASCPDPSIDATAAARNVGPP… |
| A0A2N2AL36 | 417-895 | None |
| A0A2J6J417 | 207-617 | None |
| A0A7C7QQ67 | 436-791 | None |
| A0A1V4Y9U3 | 7-256 | None |
| A0A1V6GV79 | 4-250 | None |
| A0A7C1FCE2 | 82-511 | None |
| A0A3N5INE2 | 2-276 | None |
| A0A661ED15 | 66-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.