DPCstruct | MC61492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 11.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3KSL1 | 1-124 | MVVHFVIFEDSVFASEDTDFAVFKYTWLIDKDKLLFIESGDEFGNFEVDQAFENLIVVSNTDAITINVDADRKTNITEEWYFRTSDV… |
| A0A3N9V6P9 | 54-151 | LVTIAVHFRSTYKDEERALAVVDGIWQISDTPIDVRADTQYGKMTIRTVDATNGVITMDNKDNAIVLAKKSDIELMPGIHIRTANND… |
| A0A6A2FPZ0 | 1-102 | None |
| A0A849QTF7 | 54-147 | None |
| A0A2P5K5B7 | 33-147 | None |
| A0A849Q2Q7 | 1-119 | None |
| A0A7G9YGT4 | 36-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.