DPCstruct | MC61481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7ZRS8 | 1-102 | MPKKIRLMTDYGCYPLWWDEPDQVGDLDPESLPLTQETIQRLYHWADAFEARLNLADPSDSPEVTPEEVERFEWEGLSLWKQLHQEL… |
| A0A7Z7C0N4 | 9-115 | PILEPDEPPRVDVHYEWRQYALWLSGRYGLDNVDGHEIGLSPALVRDLLLWTDTEDALFNEDDPANSPSSPNFRANGFELAKRVRAE… |
| M3TAH7 | 164-271 | None |
| A0A2Z6URR4 | 2-81 | None |
| I0H6S0 | 1-108 | None |
| A0A4S3LKF0 | 2-95 | None |
| A0A1H1ZVS5 | 1-84 | None |
| A0A268HBG2 | 3-81 | None |
| A0A5C8NE46 | 131-224 | None |
| A0A3E0VBI6 | 44-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.